DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Prss8

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:290 Identity:94/290 - (32%)
Similarity:137/290 - (47%) Gaps:43/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLVG-------------SCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWST 53
            ::.|..:||:|             ||.||     ::|.||.|..|:.||:|:|..:..   |...
  Rat    12 LEALFILLLIGLLQSRIGADGTEASCGAV-----IQPRITGGGSAKPGQWPWQVSITY---NGVH 68

  Fly    54 WCGGTLISHYWIITAAHCM---DGAESVTVYLGAINIGDESEEGQERIMVEK-SGIIVHSNYMAS 114
            .|||:|:|:.|:::||||.   ...|...|.|||..:...|.:    |:|.. :.||.||:|...
  Rat    69 VCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLDSFSND----IVVHTVAQIISHSSYREE 129

  Fly   115 TVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSP-VLRYV 178
            ....||:||||.:.|.|:..||...|| ..|..||  ..:....:|||..:.:....:| .|:.:
  Rat   130 GSQGDIALIRLSSPVTFSRYIRPICLP-AANASFP--NGLHCTVTGWGHVAPSVSLQTPRPLQQL 191

  Fly   179 EMPIMPHSLCR-MYWSGAVSEK-------MICMS-TTSGKSTCHGDSGGPLVYKQGNSSYLIGST 234
            |:|::....|. :|...||.|:       |:|.. ...||..|.|||||||........||.|..
  Rat   192 EVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIV 256

  Fly   235 SFGTSMGCQVGFPAVFTRISSYLDWILNHI 264
            |:|.:.|.. ..|.|:|..|:|..||.:|:
  Rat   257 SWGDACGAP-NRPGVYTLTSTYASWIHHHV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 84/249 (34%)
Tryp_SPc 27..260 CDD:214473 82/246 (33%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 82/247 (33%)
Tryp_SPc 45..284 CDD:238113 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.