DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CTRL

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:274 Identity:95/274 - (34%)
Similarity:150/274 - (54%) Gaps:18/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLLVCVLLVGS---CTAVPLLTDVEPY---ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTL 59
            ::.|.:.::|:||   | .:|.:.....:   |.|||.|.:|.:|:|..|..|.|  ..:|||:|
Human     3 LLSLTLSLVLLGSSWGC-GIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSG--FHFCGGSL 64

  Fly    60 ISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIR 124
            ||..|::|||||........|.||..   |.|...:...::..|..|.|.::.::|:.||::|::
Human    65 ISQSWVVTAAHCNVSPGRHFVVLGEY---DRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLK 126

  Fly   125 LPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCR 189
            |.:...:|.||....|   .:......|.:....:||||.|...:.....|:.|.:|::..:.||
Human   127 LASPAQYTTRISPVCL---ASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCR 188

  Fly   190 MYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRIS 254
            .||..::::.||| :..:|.|:|.||||||||.::||:..|||..|:||. .|.|..|||:||:|
Human   189 QYWGSSITDSMIC-AGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTK-NCNVRAPAVYTRVS 251

  Fly   255 SYLDWILNHIIAHN 268
            .:..|| |.:||:|
Human   252 KFSTWI-NQVIAYN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 85/235 (36%)
Tryp_SPc 27..260 CDD:214473 83/232 (36%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.