DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG43124

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:218 Identity:50/218 - (22%)
Similarity:79/218 - (36%) Gaps:56/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVND 119
            |.|.||::.:::|||.|....|.:||.||:    ...::..|...|.|:  .....:..:...|:
  Fly    54 CAGALINNLYVLTAASCFKENEKLTVRLGS----GYFDKSYENFRVTKA--YFWMTHFPANNTNN 112

  Fly   120 ISLIRLPAFVGFTDRIRAASL---PRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMP 181
            :.:.||...|.|...||...:   |:.| |...|:|.|.                       |.|
  Fly   113 LCIFRLQTEVEFKTHIRPMCITKSPKSL-GLATTFEIIN-----------------------EKP 153

  Fly   182 IMPHSLCR-------MYWSGAVSEKMICMSTTSGKSTCHGDSGGPL--VYKQGNSSYLIGSTSFG 237
            .|.: .|:       .|..|...||.  .|..:|.......|.||.  :.:.|..||....|   
  Fly   154 KMWY-FCKNIKGLFCKYVFGENEEKW--QSKPTGSPWTETISNGPFKGLVRYGILSYRDNKT--- 212

  Fly   238 TSMGCQVGFPAVFTRISSYLDWI 260
                    :..|:..:.|:::||
  Fly   213 --------YDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 50/218 (23%)
Tryp_SPc 27..260 CDD:214473 48/216 (22%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.