DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG43125

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:306 Identity:65/306 - (21%)
Similarity:109/306 - (35%) Gaps:118/306 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLV---GSC-------------TAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGN 50
            ::|.|..||:   ||.             :..|.|..:.|.:::               |::   
  Fly     5 LRLAVFALLLFYQGSALFLEQNCGKSSVFSPAPWLVKIRPELSS---------------NIT--- 51

  Fly    51 WSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAIN--IGDESEEGQERIMVEKSGIIVHSNYMA 113
                |.||||:..:::|||.|:|....:.|.||.|:  :.:.|:...|.|.|.::  ::|.:|.:
  Fly    52 ----CTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARA--LIHRSYSS 110

  Fly   114 STVVNDISLIRLPAFVGFTDRIR-------AASLPRRLNGQFPTYE------------------- 152
            .:...:|:|:||...|.:...|:       ...:|:.     ||:|                   
  Fly   111 ESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKA-----PTFEIEKKKNEEPKKNKAGIMKR 170

  Fly   153 SIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSG 217
            .:..|.|.:|......|.:.|     ..||            ||                    |
  Fly   171 FLNWFLSLFGVREPRPDVILP-----PQPI------------AV--------------------G 198

  Fly   218 GPLVYKQGNSSYLI---GSTSFGTSMGCQVGFPAVFTRISSYLDWI 260
            .||. ||.|.|.|.   |..|...|...:    .|:|.:.:|::||
  Fly   199 WPLT-KQINESALFHQYGILSHRNSESKK----DVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 56/265 (21%)
Tryp_SPc 27..260 CDD:214473 54/263 (21%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.