DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Cela1

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:281 Identity:94/281 - (33%)
Similarity:147/281 - (52%) Gaps:28/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLLV--CVLLVGSCTA-VPLLTDVEPYITNGEPAEVGQFPYQAGLNVSF-GNWSTWCGGTLIS 61
            |::.||  .::|.|..|. ||   :.:..:..|..|....:|.|..|...: |:|...||||||.
Mouse     1 MLRFLVFASLVLCGHSTEDVP---ETDARVVGGAEARRNSWPSQISLQYQYGGSWHHTCGGTLIR 62

  Fly    62 HYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVV--NDISLIR 124
            ..|::|||||:|...:..|.:|..|: .:::..::.:.|:|  |:.|..:..:.||  .||:|:|
Mouse    63 SNWVMTAAHCVDSPMTYRVVVGEHNL-SQNDGTEQYVNVQK--IVSHPYWNKNNVVAGYDIALLR 124

  Fly   125 LPAFVGFTDRIRAASLPRR---LNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHS 186
            |...|...:.::...|||.   |....|.|      .:|||| :..:..::..|:...:|.:.:|
Mouse   125 LAKSVTLNNYVQLGVLPREGTILANNSPCY------ITGWGR-TRTNGELAQTLQQAYLPSVSYS 182

  Fly   187 LC--RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLI-GSTSFGTSMGCQVG-FP 247
            :|  ..||..:|...|:|......:|.|.||||||| :...|..|.: |.|||.:||||.|. .|
Mouse   183 ICSSSSYWGSSVKNTMVCAGGDGVRSGCQGDSGGPL-HCMVNGQYAVHGVTSFVSSMGCNVARKP 246

  Fly   248 AVFTRISSYLDWILNHIIAHN 268
            .||||:|:|:.| :|::||.|
Mouse   247 TVFTRVSAYISW-MNNVIASN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 82/245 (33%)
Tryp_SPc 27..260 CDD:214473 81/242 (33%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 81/242 (33%)
Tryp_SPc 27..262 CDD:238113 83/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.