DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and PRSS21

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:300 Identity:86/300 - (28%)
Similarity:134/300 - (44%) Gaps:68/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGSCTAVPLLTDVEPY------------ITNGEPAEVGQFPYQAGLNVSFGNW-STWC 55
            ||:.:||..:....|...:..|.            |..||.||:|::|:|..|.:    | |..|
Human     7 LLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRL----WDSHVC 67

  Fly    56 GGTLISHYWIITAAHCMDGAESVTVYLGAINIGDES----EEGQ--------------ERIMVEK 102
            |.:|:||.|.:|||||.:...         ::.|.|    :.||              .|..|  
Human    68 GVSLLSHRWALTAAHCFETYS---------DLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFV-- 121

  Fly   103 SGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYE---SIRAFASGWG-- 162
            |.|.:...|:.::.. ||:|::|.|.|.:|..|:...|      |..|:|   ....:.:|||  
Human   122 SNIYLSPRYLGNSPY-DIALVKLSAPVTYTKHIQPICL------QASTFEFENRTDCWVTGWGYI 179

  Fly   163 RESDASDSVSPVLRYVEMPIMPHSLC-----RMYWSGAVSEKMICM-STTSGKSTCHGDSGGPLV 221
            :|.:|..| ...|:.|::.|:.:|:|     :..:...:...|:|. :...||..|.|||||||.
Human   180 KEDEALPS-PHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLA 243

  Fly   222 YKQGNSSYLIGSTSFGTSMGC-QVGFPAVFTRISSYLDWI 260
            ..:....|.||..|:|  :|| :...|.|:|.||.:.:||
Human   244 CNKNGLWYQIGVVSWG--VGCGRPNRPGVYTNISHHFEWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 79/264 (30%)
Tryp_SPc 27..260 CDD:214473 78/263 (30%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 79/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.