DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG42694

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:234 Identity:51/234 - (21%)
Similarity:93/234 - (39%) Gaps:37/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QAGLNVSFGNWS-TWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSG 104
            |||......|.: ..|.|:|||..::::||.|:|....:.|.||..|......      ....|.
  Fly    43 QAGWLAHISNGTHVLCSGSLISKQFVLSAAQCIDVHGKLFVQLGVSNATKSPH------WYTVSN 101

  Fly   105 IIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAF----ASGWGRES 165
            :::.| :....:..||.|::|...|.:.|.:....:....|    |.:.::..    .|.|    
  Fly   102 VVIPS-HSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTN----TLDMVKILQNFTTSAW---- 157

  Fly   166 DASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYL 230
             .|.:.:|  :.:.:..:....|::..||.|:.|.||.::....::|..|||..|.......|.:
  Fly   158 -LSKNKNP--QTIVLSQLSRDRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNI 219

  Fly   231 IGSTSFGTSMGCQVGF---------PAVFTRISSYLDWI 260
            :....||..     |:         ||::..::..:.||
  Fly   220 VREMLFGIR-----GYVNGRSWCSEPAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 51/234 (22%)
Tryp_SPc 27..260 CDD:214473 49/232 (21%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 48/231 (21%)
Tryp_SPc 46..253 CDD:214473 46/229 (20%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.