DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and zgc:163079

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:273 Identity:79/273 - (28%)
Similarity:134/273 - (49%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLLVCVLLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWI 65
            ::.:..|:.....|...||.|.    |..|..|..|.:|:||.:|:. .....:|||:||:..|:
Zfish    14 LLNIAGCLGQSDVCGRAPLNTK----IIGGLNATQGSWPWQASINLK-ATEEFYCGGSLINKGWV 73

  Fly    66 ITAA--HCMDGAESVTVYLGAINIGDESEEGQERIMVEK--SGIIVHSNYMASTVVNDISLIRLP 126
            :|.|  ..:..|..:.||||.     :::.|.....:.:  :.||.|.||  :::.::::|::|.
Zfish    74 LTTAKVFALMPASDIVVYLGR-----QTQNGSNPYEISRTVTKIIKHPNY--NSLDSNLALLKLS 131

  Fly   127 AFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWG---RESDASDSVSP-VLRYVEMPIMPHSL 187
            :.|.|:|.|:...| ......|  .:...::.:|||   |.:...:.:.| ||:.||.||:.:..
Zfish   132 SPVTFSDYIKPVCL-AAAGSVF--VDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFE 193

  Fly   188 CRMYWSGAVSEKMICMS--TTSGKSTCHGDSGGPLVYKQGN---SSYLIGSTSFGTSMGCQVGFP 247
            |...:.|.::.|::|..  ...||:.|.||.|||||.|||.   .|.::.|...|..     |:|
Zfish   194 CNAAYGGIITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGYCGLP-----GYP 253

  Fly   248 AVFTRISSYLDWI 260
            .::.|:|.|.|||
Zfish   254 TIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 74/247 (30%)
Tryp_SPc 27..260 CDD:214473 72/245 (29%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 72/250 (29%)
Tryp_SPc 36..267 CDD:238113 74/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.