DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:269 Identity:81/269 - (30%)
Similarity:128/269 - (47%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITA 68
            |..|:..|  |...||    ...|..|..|..|.:|:|  :::..|:....|||::|:..|:::|
Zfish    15 LSTCLAQV--CGRPPL----GKRIVGGVEASPGSWPWQ--VDIQMGSNGHVCGGSIIAKNWVLSA 71

  Fly    69 AHCMDGAESVTVYLGAINIGDESEEGQERIMVEK----SGIIVHSNYMASTVVNDISLIRLPAFV 129
            |||......|:.|  .:.:|.....|..:.  ||    ..:::...|.......|::|::|.|.|
Zfish    72 AHCFPNPSEVSAY--TLYMGRHLLNGYNQF--EKVSYVQRVVIPEGYTDPQGGRDVALVQLRAPV 132

  Fly   130 GFTDRIRAASLPRRLNGQFPTYESIRAFASGWG-RESDASDSVSPVLRYVEMPIMPHSLCRMYWS 193
            .:||||:...||   ...|........:.:||| ::...|.:.:..||.||:||:..|.|:..:.
Zfish   133 SWTDRIQPVCLP---FADFQFNSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQFMYQ 194

  Fly   194 GAVSEK--------MICMS-TTSGKSTCHGDSGGPLVYKQGNSSYL-IGSTSFGTSMGC-QVGFP 247
            ...|:.        |||.. ...||.:|.||||||||...||.::: .|..|||  :|| |...|
Zfish   195 ILSSDSSTVDILSDMICAGYKEGGKDSCQGDSGGPLVCPVGNGTWIQAGVVSFG--LGCAQKNRP 257

  Fly   248 AVFTRISSY 256
            .:::|:||:
Zfish   258 GIYSRVSSF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 75/246 (30%)
Tryp_SPc 27..260 CDD:214473 75/246 (30%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.