DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and PRSS27

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:267 Identity:77/267 - (28%)
Similarity:123/267 - (46%) Gaps:57/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            |:.||:..:..::|:||.:   :.|..: :||.|||:::::||||||.......:.|   .:.|.
Human    34 RMVGGQDTQEGEWPWQVSI---QRNGSH-FCGGSLIAEQWVLTAAHCFRNTSETSLY---QVLLG 91

  Fly    96 PRQLIRSTNP--------EVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLS----SS 148
            .|||:: ..|        :|..:|.:...:...|:|||.|.......:.|.|:.||..|    :.
Human    92 ARQLVQ-PGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETG 155

  Fly   149 RNSYDYVPAIASGWGRMNDE------------STAISD----NLRYVYRFVESNEDCEYSY--AN 195
            .|.:      .:|||..::|            :..|.|    ||.|       ::|.|:.|  ..
Human   156 MNCW------VTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLY-------SKDTEFGYQPKT 207

  Fly   196 IKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAY 258
            ||...:|.. ..|.|..|.||||||||..  |..:.:..||.|:|:  ||.: ..|.|:.|:||:
Human   208 IKNDMLCAGFEEGKKDACKGDSGGPLVCL--VGQSWLQAGVISWGE--GCARQNRPGVYIRVTAH 268

  Fly   259 LDWIGEV 265
            .:||..:
Human   269 HNWIHRI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/262 (29%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 75/262 (29%)
Tryp_SPc 36..275 CDD:238113 76/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.