DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and TMPRSS5

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:269 Identity:78/269 - (28%)
Similarity:130/269 - (48%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SISCLDMG-HGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVE-- 79
            |:.|.:.| ..:..||.||:.....::|:|..:::...:.    ||.|:::.|:::|||||:.  
Human   203 SLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRHT----CGGSVLAPRWVVTAAHCMHSF 263

  Fly    80 ---KAVAITYYLGGVLRLA--PRQ--LIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSI 137
               :..:...:.|.|...|  |.|  |:....|    ||.::.|:.:.|:||:||.......|::
Human   264 RLARLSSWRVHAGLVSHSAVRPHQGALVERIIP----HPLYSAQNHDYDVALLRLQTALNFSDTV 324

  Fly   138 RPIRLPGLSS--SRNSYDYVPAIASGWGRMNDESTAISDNLR----YVYRFVESNEDCEYSYANI 196
            ..:.||....  .:.|..:|    ||||..:...|..||.|:    .::.....|..|.||.| :
Human   325 GAVCLPAKEQHFPKGSRCWV----SGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGA-L 384

  Fly   197 KPTNICMDTTGGKS-TCTGDSGGPLVYSDPVQNADI--LIGVTSYGKKSGCTK-GYPSVFTRITA 257
            .|..:|.....|:: .|.||||||||..|    .|.  |:||.|:|:  ||.: .:|.|:.::..
Human   385 TPRMLCAGYLDGRADACQGDSGGPLVCPD----GDTWRLVGVVSWGR--GCAEPNHPGVYAKVAE 443

  Fly   258 YLDWIGEVS 266
            :||||.:.:
Human   444 FLDWIHDTA 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/249 (29%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 3/9 (33%)
Tryp_SPc 217..448 CDD:214473 73/249 (29%)
Tryp_SPc 218..451 CDD:238113 74/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.