DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Tmprss5

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:270 Identity:75/270 - (27%)
Similarity:126/270 - (46%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GR--SISCLDMG-HGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHC 77
            ||  |:.|.:.| ..:..||.||:...:.::|:|..:.:...:.    ||||:::..:::|||||
Mouse   199 GRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVMLGSRHT----CGASVLAPHWVVTAAHC 259

  Fly    78 -----VEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSI 137
                 :.:..:...:.|.|...|.||...:...::..||.::.|:.:.|:||::|.......|::
Mouse   260 MYSFRLSRLSSWRVHAGLVSHGAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTV 324

  Fly   138 RPIRLPGLSSSRNSYDYVP----AIASGWGRMNDESTAISDNLR---------YVYRFVESNEDC 189
            ..:.||.      ...:.|    ...||||..:...|..||.|:         |:     .|..|
Mouse   325 GAVCLPA------KEQHFPWGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTYL-----CNSSC 378

  Fly   190 EYSYANIKPTNICMDTTGGKS-TCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVF 252
            .||.| :....:|.....|:: .|.||||||||.  |..:...|:||.|:|:  ||.: ..|.|:
Mouse   379 MYSGA-LTHRMLCAGYLDGRADACQGDSGGPLVC--PSGDTWHLVGVVSWGR--GCAEPNRPGVY 438

  Fly   253 TRITAYLDWI 262
            .::..:||||
Mouse   439 AKVAEFLDWI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 68/250 (27%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 5/13 (38%)
Tryp_SPc 217..448 CDD:214473 68/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.