DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and tmprss4a

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_005157547.1 Gene:tmprss4a / 777630 ZFINID:ZDB-GENE-061103-631 Length:458 Species:Danio rerio


Alignment Length:264 Identity:80/264 - (30%)
Similarity:128/264 - (48%) Gaps:34/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SISC-LDMGHGIG-GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV-- 78
            |:|| .|.|.... .||.||:.|....:|:||.|.....:.    ||.||::..:::|||||.  
Zfish   208 SLSCSADCGLSRNQDRIVGGKDADIANWPWQVSLQYSGQHT----CGGSLVTPNWVVTAAHCFNG 268

  Fly    79 --EKAVAITYYLGGVLRLA--PRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRP 139
              .||::....:.|:..|:  |...::    |:.::.::.....:.||.:::|.....|.:|.||
Zfish   269 DGRKALSRWTVVSGITYLSSTPSSYVK----EIIVNSNYKPAESDFDITMIKLQSPITLSESRRP 329

  Fly   140 IRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE----YSYANIKPTN 200
            :.||..:......|.:  :.:|||.|.::..::|..|:.....|..:..|.    |. ::|.|..
Zfish   330 VCLPPQNLGLKGGDGL--VVTGWGHMAEKGGSLSSMLQKAQIQVIDSAQCSSPTVYG-SSITPRM 391

  Fly   201 ICMDT-TGGKSTCTGDSGGPLVYSDPVQNAD--ILIGVTSYGKKSGCTK-GYPSVFTRITAYLDW 261
            ||... .||...|.||||||||:.     ||  :|:||.|:|  .||.: |:|.|:|.:...|||
Zfish   392 ICAGVMAGGVDACQGDSGGPLVHL-----ADRWVLVGVVSWG--VGCARPGFPGVYTNVDQMLDW 449

  Fly   262 IGEV 265
            ...|
Zfish   450 AHSV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 73/244 (30%)
tmprss4aXP_005157547.1 LDLa 74..105 CDD:238060
SRCR_2 121..218 CDD:295335 5/9 (56%)
Tryp_SPc 223..449 CDD:214473 72/243 (30%)
Tryp_SPc 224..449 CDD:238113 71/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.