DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and st14b

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:267 Identity:88/267 - (32%)
Similarity:125/267 - (46%) Gaps:55/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITY--------Y 87
            ||.||:.:...::|:||.|.::....:   ||||:||:.:|:||||||:......|        |
Zfish   624 RIVGGKDSDEGEWPWQVSLHMKTQGHV---CGASVISNSWLVTAAHCVQDNDQFRYSQADQWEVY 685

  Fly    88 LG-------------GVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRP 139
            ||             .|||:.|             ||.::..|.:|||||:.|.....|..:|.|
Zfish   686 LGLHNQGETSKSTQRSVLRIIP-------------HPQYDHSSYDNDIALMELDSPVTLNQNIWP 737

  Fly   140 IRLPGLSSSRNSYDYVPAIAS----GWGRMNDESTAISDNLRYV-YRFVESNEDCEYSYANIKPT 199
            |.||      :...|.||..|    |||::.:.|.|:...|:.. .|.:.|....:.....|.|.
Zfish   738 ICLP------DPTHYFPAGKSVWITGWGKLREGSDAVPSVLQKAEVRIINSTVCSKLMDDGITPH 796

  Fly   200 NICMDT-TGGKSTCTGDSGGPLVYSDPVQNADI-LIGVTSYGKKSGC-TKGYPSVFTRITAYLDW 261
            .||... :||...|.||||||:  |....|..: |.||.|:|  .|| .:..|.|:||:|.|..|
Zfish   797 MICAGVLSGGVDACQGDSGGPM--SSIEGNGRMFLAGVVSWG--DGCGRRNRPGVYTRVTDYRSW 857

  Fly   262 IGEVSGV 268
            |.|::|:
Zfish   858 IREITGI 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 84/259 (32%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060
LDLa 578..613 CDD:238060
Tryp_SPc 624..858 CDD:214473 84/259 (32%)
Tryp_SPc 625..861 CDD:238113 85/261 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.