DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Ctrc

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:271 Identity:91/271 - (33%)
Similarity:136/271 - (50%) Gaps:22/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILVFLLILVQGRSISCLD--MGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLIS 67
            |:|..:|....    ||.|  ....:..|:.|||.|..|.:|:||.|.....:.....||.|||:
Mouse     5 TVLAAILACAS----SCGDPTFPPNLSARVVGGEDAVPNSWPWQVSLQYLRDDTWRHTCGGSLIT 65

  Fly    68 DRYLLTAAHCVEKAVAITYYLG-GVLRLAPRQLIRSTNPEV---HLHPDWNCQSLENDIALVRLP 128
            ..::||||||:.  ..:||.:| |...|.......|...||   ::|..||...|.||||:::|.
Mouse    66 TSHVLTAAHCIN--TNLTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLLLWNDIAIIKLA 128

  Fly   129 EDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC---E 190
            |...|.|:|:...:|...|.... || |...:||||:.... .|::.|:...:.:.::..|   :
Mouse   129 EPVELSDTIQVACIPEQDSLLPG-DY-PCYVTGWGRLWTNG-PIAEVLQQGLQPIVNHTTCSRLD 190

  Fly   191 YSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILI-GVTSYGKKSGC-TKGYPSVFT 253
            :.:..::.|.:|....|..|.|.|||||||  :.||::....: |:.|:|...|| |...|.|||
Mouse   191 WWFIKVRETMVCAGGDGVISACNGDSGGPL--NCPVEDGLWQVHGIVSFGSSRGCNTYKKPVVFT 253

  Fly   254 RITAYLDWIGE 264
            |::||:|||.|
Mouse   254 RVSAYIDWIKE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 82/239 (34%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 82/239 (34%)
Tryp_SPc 30..265 CDD:238113 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.