DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and tmprss4

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_012822151.1 Gene:tmprss4 / 733869 XenbaseID:XB-GENE-940762 Length:785 Species:Xenopus tropicalis


Alignment Length:269 Identity:77/269 - (28%)
Similarity:122/269 - (45%) Gaps:52/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SISCLDMGHG-IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKA 81
            |:.|...|.| ...||.||..:...::|:||.|.....:    .||.|:::.|::|.||||.::.
 Frog   537 SLRCAACGTGHKQERIIGGSNSDILKYPWQVSLQYMGQH----ICGGSILNSRWILCAAHCFDRG 597

  Fly    82 -------------VAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALL 133
                         ..:||..|..:            .::.|:..:......|||||::|..|.:.
 Frog   598 QRQVDRWRVQYGITTLTYLFGTFV------------DKIFLNSKYVTDQKPNDIALLQLKSDIVA 650

  Fly   134 CDSIRPIRLPGLSSSRNSYD---YVPAI--ASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY 193
            ..|::|:.|||       ||   .|.|:  .:|||...:...|::..|:.|...:.|:..|...|
 Frog   651 SASVQPVCLPG-------YDNNLVVGAVLYVTGWGHTVEGGAALASQLQEVAISLISSTTCNQEY 708

  Fly   194 -ANIKPTNICM-DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPS---VFT 253
             ..|..|.:|. ...||..||.||||||||......:.: .:|:.|:|  .||  |.|:   |:|
 Frog   709 GGQILDTMLCAGKIAGGADTCQGDSGGPLVSLGQSSHWE-QVGIVSWG--DGC--GRPNRVGVYT 768

  Fly   254 RITAYLDWI 262
            .:.::|:||
 Frog   769 DVQSFLNWI 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 71/253 (28%)
tmprss4XP_012822151.1 ATF7IP_BD <110..233 CDD:293393
PHA03193 <206..340 CDD:177555
LDLa 402..434 CDD:238060
SRCR_2 453..545 CDD:292133 2/7 (29%)
SRCR 464..541 CDD:278931 1/3 (33%)
Tryp_SPc 551..777 CDD:214473 71/253 (28%)
Tryp_SPc 552..777 CDD:238113 70/252 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.