DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and XB5723326

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:226 Identity:59/226 - (26%)
Similarity:99/226 - (43%) Gaps:38/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CGASLISDRYLLTAAHCVE-----------KAVAITYYLGGV-LRLAPR---QLIRSTNPEVHLH 110
            |..:::::.:::|||||.:           :.:..|:||..: ||...|   |||:        |
 Frog    45 CAGTILNNEWIITAAHCFKDWKEGDPTTPLRVLLGTFYLSEIGLRTQSRGVKQLIK--------H 101

  Fly   111 PDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMN---DESTAI 172
            ..::..:..|||||::|.:.....|.|:....|  ..|.:..|.:....:|||...   ||.:..
 Frog   102 DQYDPITESNDIALIQLDKQVEFSDHIQQACFP--KESADLKDLIDCSIAGWGAQGKHLDEPSQF 164

  Fly   173 SDNLRYVYRFVE--SNEDCEYSYANIKPTN-ICM-DTTGGKSTCTGDSGGPLVYSDPVQNADILI 233
            ....:     ||  ..:.|...|..|...| :|. ...|.:.||.||.|.||:......|...:|
 Frog   165 LQEAQ-----VERIDTKHCNKWYQGILGENHLCAGHRKGPEKTCNGDRGSPLMCRTKKNNVYSVI 224

  Fly   234 GVTSYGKKSGCTKGYPSVFTRITAYLDWIGE 264
            |:.::|...|.|:. |.|::.|.:::.||.|
 Frog   225 GILNWGSGCGQTRS-PGVYSPIQSHIKWIVE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 56/222 (25%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 56/222 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.