DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss44

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:274 Identity:77/274 - (28%)
Similarity:130/274 - (47%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GRSISCLDM---------------GHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASL 65
            |:|.|.:.:               ||.. .||.||..|.|.::|:||.|.:.:.:    .||.||
Mouse    82 GQSFSTMSLSRQPFPTWVPPTSACGHRT-ARIVGGRPAPARKWPWQVSLQVHKQH----ICGGSL 141

  Fly    66 ISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWN-CQSLENDIALVRLPE 129
            ||..:::||||||...:....::|.. .|..::.:|....::.:|.|:: .:::.:|||||.|..
Mouse   142 ISKWWVITAAHCVYGHLDYAVFMGDA-DLWSKRPVRIPVQDIIVHQDFSMMRTVVHDIALVLLAF 205

  Fly   130 DALLCDSIRPIRLPGLSSSRNSYDYVPAI---ASGWGRMNDE--STAISDNLRY-VYRFVESNED 188
            ......:|:|:.:|     ..|:...|..   .:|||::.::  |:.|...:.. :.|..:.|:.
Mouse   206 PVNYSVNIQPVCIP-----EKSFLVQPGTLCWVTGWGKVLEQGRSSRILQEIELNIIRHEKCNQI 265

  Fly   189 CEYSYANI----KPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GY 248
            .:....||    :...:|.....|...|.||||||||..  .....:.:|:.|:|  .||.: ||
Mouse   266 LKDIMGNIFTLVQEGGVCGYNEKGGDACQGDSGGPLVCE--FNKTWVQVGIVSWG--LGCGRIGY 326

  Fly   249 PSVFTRITAYLDWI 262
            |.|:|.::.|.|||
Mouse   327 PGVYTEVSYYRDWI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 70/242 (29%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 70/242 (29%)
Tryp_SPc 112..340 CDD:238113 69/241 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.