DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and C1R

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:259 Identity:76/259 - (29%)
Similarity:122/259 - (47%) Gaps:51/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV-------EKAVAITYYL 88
            ||.||:.|:...||:||..:|....      |.:|:.||::|||||.:       :...::..:|
Human   477 RIIGGQKAKMGNFPWQVFTNIHGRG------GGALLGDRWILTAAHTLYPKEHEAQSNASLDVFL 535

  Fly    89 G-----GVLRLAPRQLIRSTNPEVHLHPDW---NCQSLENDIALVRLPEDALLCDSIRPIRLPGL 145
            |     .:::|....:.|     |.:|||:   ...:.|.||||:.|.....|..::.||.||  
Human   536 GHTNVEELMKLGNHPIRR-----VSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLP-- 593

  Fly   146 SSSRNSYD-----YVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCE-----YSYANIKPTN 200
             .:...||     ||    ||:|.|.::   |:.:||:|...|.:.:.||     .:..::...|
Human   594 -DNDTFYDLGLMGYV----SGFGVMEEK---IAHDLRFVRLPVANPQACENWLRGKNRMDVFSQN 650

  Fly   201 I-CMDTTGGK-STCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            : |......| ..|.|||||.....||..:..:..|:.|:|  .||::|| ..:|::..|:|||
Human   651 MFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWG--IGCSRGY-GFYTKVLNYVDWI 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/257 (29%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569
Tryp_SPc 477..711 CDD:214473 74/257 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.