DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss41

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:263 Identity:71/263 - (26%)
Similarity:122/263 - (46%) Gaps:56/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAV---AITYYLGGVL 92
            ||.||..:...::|:|..|.:::.:.    ||.||:|.|::||||||..|.:   ..|..||.:.
Mouse    83 RIVGGIESMQGRWPWQASLRLKKSHR----CGGSLLSRRWVLTAAHCFRKYLDPEKWTVQLGQLT 143

  Fly    93 -------------RLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRL-P 143
                         |...:.:|.::..::..|          |:||:||.........|:|:.: |
Mouse   144 SKPSYWNRKAYSGRYRVKDIIVNSEDKLKSH----------DLALLRLASSVTYNKDIQPVCVQP 198

  Fly   144 GLSSSRNSYDYVPAI-ASGWGRMNDESTAISD--NLRYVYRFVESNEDCE-----YSYANIKPTN 200
            ...:|::.    |.. .:|||.:.::...:..  :||.|...:.:|..|:     :|..::...:
Mouse   199 STFTSQHQ----PRCWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLHHLITKD 259

  Fly   201 I-CMDTTGGKS-TCTGDSGGPLVYSDPVQNADIL---IGVTSYGKKSGCTK-GYPSVFTRITAYL 259
            : |.....|.: ||:||||||||.     |.|.|   ||:.|:|  .||.: ..|.::|.::.|.
Mouse   260 VFCAGAEDGSADTCSGDSGGPLVC-----NMDGLWYQIGIVSWG--IGCGRPNLPGIYTNVSHYY 317

  Fly   260 DWI 262
            :||
Mouse   318 NWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 69/261 (26%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 70/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.