DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss22

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:301 Identity:82/301 - (27%)
Similarity:126/301 - (41%) Gaps:61/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILVFLLILVQGRSISC--LDMGHGIG-----GRIAGGELARANQFPYQVGLSIEEPNDMYCWCG 62
            :||:.|::|.....||.  :.:....|     .||.|||.:...|:|:.|  ||.:....:  |.
Mouse    74 SILILLVLLTSTAPISAATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIV--SILKNGSHH--CA 134

  Fly    63 ASLISDRYLLTAAHC----VEKAVAITYYLG--------------GVLRLAPRQLIRSTNPEVHL 109
            .||:::|:::|||||    ::|....:..||              |:..:.|             
Mouse   135 GSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLP------------- 186

  Fly   110 HP--DWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMND-ESTA 171
            ||  .|. :....|||||||.......:.|.||.||  .||...........:|||.:.| ....
Mouse   187 HPRYSWK-EGTHADIALVRLEHSIQFSERILPICLP--DSSVRLPPKTDCWIAGWGSIQDGVPLP 248

  Fly   172 ISDNLRYVYRFVESNEDCEYSY------ANIKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNA 229
            ....|:.:...:..:|.|:..|      ..|....:|.. ..|.:..|.|||||||:..  |.:.
Mouse   249 HPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQ--VDDH 311

  Fly   230 DILIGVTSYGKKSGCT-KGYPSVFTRITAYLDWIGE-VSGV 268
            .:|.|:.|:|:  ||. :..|.|:|.:.|:..|:.. |.||
Mouse   312 WLLTGIISWGE--GCAERNRPGVYTSLLAHRSWVQRIVQGV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 71/259 (27%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 71/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.