DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Cela3b

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_080695.1 Gene:Cela3b / 67868 MGIID:1915118 Length:269 Species:Mus musculus


Alignment Length:275 Identity:94/275 - (34%)
Similarity:136/275 - (49%) Gaps:28/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLIS 67
            :|::|  |:.|..|    |....|....|:..||.|..:.:|:||.|..|:....:..||.|||:
Mouse     5 LSSLL--LVALASG----CGQPSHNPSSRVVNGEEAVPHSWPWQVSLQYEKDGSFHHTCGGSLIT 63

  Fly    68 DRYLLTAAHCVEKAVAITYYLG----GVLRLAPRQLIRSTNPEVHLHPDWN--CQSLENDIALVR 126
            ..::|||.||:..:......||    || .....|:|.....::.:||.||  |.|..||||||:
Mouse    64 PDWVLTAGHCISTSRTYQVVLGEHERGV-EEGQEQVIPINAGDLFVHPKWNSMCVSCGNDIALVK 127

  Fly   127 LPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC-- 189
            |...|.|.|:::...||  .:.....:..|...|||||::... .:.|.|:.....|...|.|  
Mouse   128 LSRSAQLGDAVQLACLP--PAGEILPNGAPCYISGWGRLSTNG-PLPDKLQQALLPVVDYEHCSR 189

  Fly   190 -EYSYANIKPTNICMDTTGG--KSTCTGDSGGPLVYSDPVQNADILI-GVTSYGKKSGC-TKGYP 249
             .:...::|.|.:|   .||  :|.|.|||||||  :.|..|....: ||||:....|| |...|
Mouse   190 WNWWGLSVKTTMVC---AGGDIQSGCNGDSGGPL--NCPADNGTWQVHGVTSFVSSLGCNTLRKP 249

  Fly   250 SVFTRITAYLDWIGE 264
            :||||::|::|||.|
Mouse   250 TVFTRVSAFIDWIEE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 84/243 (35%)
Cela3bNP_080695.1 Tryp_SPc 27..262 CDD:214473 84/243 (35%)
Tryp_SPc 28..265 CDD:238113 86/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.