DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and zgc:123217

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:254 Identity:88/254 - (34%)
Similarity:124/254 - (48%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV--EKAVAITYYLGGVLR 93
            ||.||..|.|..:|:||.:..   |:.:. ||.:||..::::|||||:  ......|.|||    
Zfish    36 RIVGGTDAPAGSWPWQVSIHY---NNRHI-CGGTLIHSQWVMTAAHCIINTNINVWTLYLG---- 92

  Fly    94 LAPRQLIRST---NP-EVHL-------HPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSS 147
               || .:||   || ||.:       ||.:|...|.|||:|::|.:.......||||.|    :
Zfish    93 ---RQ-TQSTSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICL----A 149

  Fly   148 SRNS--YDYVPAIASGWGRM-NDESTAISDNLRYVYRFVESNEDCEYSY-----ANIKPTNICMD 204
            :.||  |:.....|:|||.: .|::......|:.|...|.:|..|...|     |.|.|..||..
Zfish   150 ANNSIFYNGTSCWATGWGNIGKDQALPAPQTLQQVQIPVVANSLCSTEYESVNNATITPQMICAG 214

  Fly   205 TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKG-YPSVFTRITAYLDWI 262
             ...|.||.||||||  :.....:..|..|:||||..:||..| ||.|::|::.:..||
Zfish   215 -KANKGTCQGDSGGP--FQCKQGSVWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 86/252 (34%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 86/252 (34%)
Tryp_SPc 37..273 CDD:238113 87/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.