DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and LOC595077

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_031748571.1 Gene:LOC595077 / 595077 -ID:- Length:752 Species:Xenopus tropicalis


Alignment Length:286 Identity:76/286 - (26%)
Similarity:129/286 - (45%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVFLLILVQGRSISCLDMGHGIG-----GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLI 66
            |.|.||.:..:.::.::.....|     .||.||..::..::|:|:.|:.:  |:..  ||.|||
 Frog     5 LSFALIFIHHQVVTVVETTSACGVPVVSDRIVGGMNSKKGEWPWQISLNYK--NEFI--CGGSLI 65

  Fly    67 SDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVH-------LHPDWNCQSLENDIAL 124
            :|.:::.||||.: ::.::||   .:.|...||....|..|.       .:|::..:....||||
 Frog    66 TDSWVMAAAHCFD-SLKVSYY---TVYLGAYQLSALDNSTVSRGVKKIIKNPNFLYEGSSGDIAL 126

  Fly   125 VRLPEDALLCDSIRPIRLPG----LSSSRNSYDYVPAIASGWGRMNDESTAISD--NLRYVYRFV 183
            :.|.........|.|:.||.    |::....:      .:|||. ..|...:|:  .|:.....:
 Frog   127 MELETPVTFTPYILPVCLPSQEVQLAAGTMCW------VTGWGD-TQEGIPLSNPKTLQMAEVGI 184

  Fly   184 ESNEDCEYSYAN----------IKPTNICMDTTGGK-STCTGDSGGPLVYSDPVQNADILIGVTS 237
            .|:..||..|.:          |:...:|.....|: ..|.||||||||.:  |.|..:..|:.|
 Frog   185 ISSSSCEDMYESSFGYSTGGTFIQEDMVCAGYQEGQIDACQGDSGGPLVCN--VNNVWLQFGIVS 247

  Fly   238 YGKKSGCTK-GYPSVFTRITAYLDWI 262
            :|  .||.: ..|.|:|::..|.||:
 Frog   248 WG--YGCAEPNKPGVYTKVQYYQDWL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 70/255 (27%)
LOC595077XP_031748571.1 Tryp_SPc 35..272 CDD:238113 70/256 (27%)
Tryp_SPc 431..670 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.