DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and cela2a

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_017945752.1 Gene:cela2a / 594883 XenbaseID:XB-GENE-970278 Length:269 Species:Xenopus tropicalis


Alignment Length:273 Identity:81/273 - (29%)
Similarity:127/273 - (46%) Gaps:27/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDR 69
            |.|:.|::.:.|.....:.....:..|:..||....:.:|:||.|........|..||.||||..
 Frog     2 TPLLVLVLCLAGAYCCGVPTYQPVVSRVVNGEDVAPHSWPWQVSLQYLYYGYWYHTCGGSLISSN 66

  Fly    70 YLLTAAHCVEKAVAITYYLG--GVLRLAPRQLIRSTNPEVHLHPDWNCQSLEN--DIALVRLPED 130
            ::||||||:.........||  .:..:.|.|.|.:.:..:: ||.|:..||.|  ||:|::|.|.
 Frog    67 WVLTAAHCISSYNTYRVQLGKHNLRYIEPGQKIINVSKLIN-HPRWDPNSLGNGFDISLIKLEES 130

  Fly   131 ALLCDSIRPIRLP--GLSSSRNSYDYVPAIASGWGRM---NDESTAISDNLRYVYRFVESNEDCE 190
            ....|:::|..||  |.........||    :|||.:   ..|...:...|..|..:...:: .:
 Frog   131 VDFSDTVQPACLPPAGYILPHQYGCYV----TGWGNIRTGGPEPDILQQGLLLVVDYATCSQ-WD 190

  Fly   191 YSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNAD---ILIGVTSYGKKSGCTKGY---P 249
            :....::...||....|..|:|.|||||||    ..:||:   .:.||.|:|..:||  .|   |
 Frog   191 WWGDGVRTNMICAGGDGITSSCNGDSGGPL----NCRNANGTWEVHGVVSFGSAAGC--NYPKKP 249

  Fly   250 SVFTRITAYLDWI 262
            |||:|::.:..||
 Frog   250 SVFSRVSEFNSWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/245 (31%)
cela2aXP_017945752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.