DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and CG34409

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:300 Identity:74/300 - (24%)
Similarity:126/300 - (42%) Gaps:62/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPY--QVGLSIEEPNDMYCWCGASL 65
            :||....:....|..:..|   |..:..|:.||:.|.|.|||:  ::.......:.:...|..||
  Fly   224 LSTTTASMPPFAQENTQGC---GINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSL 285

  Fly    66 ISDRYLLTAAHCVEKAVA---ITYY-LG---GVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIA 123
            ||..:::||||||...|:   :::. ||   |....|..|:|        :||:::.....||||
  Fly   286 ISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATPFAIEQVI--------VHPNYDQPKYANDIA 342

  Fly   124 LVRLPEDALLCDSIRPIRLP--GLSSSRNSYDYVPAIASGWGRMNDESTAISD------NLRYVY 180
            |:|:....   .:..||.||  |..:..|.......:|:||...:.|:.:..|      .:|::.
  Fly   343 LLRINSTN---GTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIR 404

  Fly   181 RFVESNEDCEYSYAN----------IKPTNICMDTTGGKSTCTGDSGGPLV-------------Y 222
            ..:.:...|..:||:          |.|.::|.........|.||||||.:             |
  Fly   405 LPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRY 469

  Fly   223 SDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            :        :||:.::|.........|.|:|.::::.|||
  Fly   470 T--------IIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/270 (25%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 67/270 (25%)
Tryp_SPc 252..501 CDD:238113 66/267 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.