DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and tmprss5

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:261 Identity:79/261 - (30%)
Similarity:125/261 - (47%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEK------------AVA 83
            ||.||..|...::|:||.|..   |:.:. ||.|:|::::::||||||..            |..
Zfish   311 RIIGGVEAALGRWPWQVSLYY---NNRHI-CGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAGI 371

  Fly    84 ITYYLGGVLR---LAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGL 145
            ||..|..:.:   .|..::|.:.|        :|.::.:||||||:|.......|:|||:.||  
Zfish   372 ITSNLAKLAQYQGFAVERIIYNKN--------YNHRTHDNDIALVKLKTPLNFSDTIRPVCLP-- 426

  Fly   146 SSSRNSYDY-----VPAIASGWGRMNDESTAISDNLRY----VYRFVESNEDCEYSYANIKPTNI 201
                 .||:     .....||||....:...|.:.|:.    :....:.|..|.|: ..|....:
Zfish   427 -----QYDHDLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCMYN-GEITSRML 485

  Fly   202 CMDTTGGK-STCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWIGE 264
            |...:.|| ..|.||||||||..|  :|...|:||.|:|  :||.: .:|.|::::..:|.||.:
Zfish   486 CAGYSEGKVDACQGDSGGPLVCQD--ENVWRLVGVVSWG--TGCAEPNHPGVYSKVAEFLGWIYD 546

  Fly   265 V 265
            :
Zfish   547 I 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/256 (30%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 77/256 (30%)
Tryp_SPc 312..547 CDD:238113 78/258 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.