DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and si:dkey-21e2.15

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_003201076.1 Gene:si:dkey-21e2.15 / 567711 ZFINID:ZDB-GENE-050208-780 Length:251 Species:Danio rerio


Alignment Length:274 Identity:88/274 - (32%)
Similarity:143/274 - (52%) Gaps:34/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLIS 67
            ::.|::.||:||.  .:..|.....:|  |..|..|:.:..||.|.|.....|.    ||.|||:
Zfish     1 MTIIIISLLLLVS--LVPDLTFTARVG--IEDGTEAKPHSRPYMVSLQKNSKNS----CGGSLIT 57

  Fly    68 DRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHL-HPDWNCQSLENDIALVRLPEDA 131
            :.::||||||.:|...||..: |...|:..:...|.....:: ||:::.|:.||||.|::|.:..
Zfish    58 EEFVLTAAHCWKKGDVITVVV-GAHDLSENETYDSFEVTSYIPHPEFSWQNYENDIMLLKLNKKV 121

  Fly   132 LLCDSIRPIRLPGLSSSRNSYDY-VPAIAS--GWGR--MNDESTAISDNLRYVYRFVESNEDCEY 191
            .|.:::..|.||     :|..|. ..|:.|  ||||  :|...   .|.|......:.|.|:|:.
Zfish   122 TLSNNVGLISLP-----KNGEDVKEDAVCSVAGWGRLWLNGPR---PDRLMEAETVIVSGEECKR 178

  Fly   192 SYANI-KPTNI-CMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC-TKGYPSVFT 253
            .:.:: ||:.: |:...||  ||.||||||||..:..      :||||:..:..| ::..|:::|
Zfish   179 RWESLFKPSKMFCVYGHGG--TCKGDSGGPLVCGEHA------VGVTSFSDRYSCNSRLLPNMYT 235

  Fly   254 RITAYLDWIGEVSG 267
            :|:|||.||.:::|
Zfish   236 KISAYLSWIQKITG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 78/239 (33%)
si:dkey-21e2.15XP_003201076.1 Tryp_SPc 26..247 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.