DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP011919

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001689275.1 Gene:AgaP_AGAP011919 / 5667955 VectorBaseID:AGAP011919 Length:262 Species:Anopheles gambiae


Alignment Length:273 Identity:80/273 - (29%)
Similarity:138/273 - (50%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLIS 67
            ::.|:.||.:.|.|.|.:...:.....|||.||..||...||||.  |....:.|:. ||.::::
Mosquito     7 VALIVCFLAVAVSGESATSDPLYQQWKGRIVGGTYARDGDFPYQA--SFRTLDGMHI-CGGAVLN 68

  Fly    68 DRYLLTAAHCV-EKAVAITYYLGGVLRLAP-------RQLIRSTNPEVHLHPDWNCQSLENDIAL 124
            .::::|||.|: .::.|.|..:.|..||:.       |:::        :||::...:|.||:|:
Mosquito    69 QQWVITAASCLFGRSTADTRVVVGAYRLSQGGFNLGLRRIV--------IHPNFASATLANDVAV 125

  Fly   125 VRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC 189
            .|:.:..:|.|:::.::|    .|.|......|:.|||||....:....|||:|:...|.|..:|
Mosquito   126 ARVAQQMVLSDAVQGVQL----GSYNINVAYGALVSGWGRTEFSNPQFPDNLQYIAVNVISQLEC 186

  Fly   190 EYSY-----ANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYP 249
            ...:     |.|..:.:|..:..|:.||.||:|.||::...      |.|:.|:|  ..|.:|||
Mosquito   187 RARFAAPYDARIYDSTMCSSSPVGQGTCLGDAGSPLIHGAE------LHGIVSWG--IPCGEGYP 243

  Fly   250 SVFTRITAYLDWI 262
            .|:.||:::..||
Mosquito   244 DVYARISSHRGWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 71/243 (29%)
AgaP_AGAP011919XP_001689275.1 Tryp_SPc 35..256 CDD:214473 71/243 (29%)
Tryp_SPc 36..256 CDD:238113 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.