DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP005705

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001688714.1 Gene:AgaP_AGAP005705 / 5667318 VectorBaseID:AGAP005705 Length:311 Species:Anopheles gambiae


Alignment Length:245 Identity:78/245 - (31%)
Similarity:115/245 - (46%) Gaps:16/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRL 94
            |||..|.:......||.||:.:......| :||..|:|..::||:|.|||...:||..||.    
Mosquito    71 GRINNGVIVGPTDVPYIVGVLVSVEQGTY-FCGGVLVSRTHVLTSATCVEGQTSITVLLGA---- 130

  Fly    95 APRQLIRSTN----PEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYV 155
              ..:.|:.:    ..|.:|||::.....||:|::.|.......|.|:..|||..|....|:...
Mosquito   131 --SDITRAQDFVVVSHVRVHPDFSSFFQANDLAILTLSRMPRFNDQIQLARLPRRSQVGESFTNA 193

  Fly   156 PAIASGWGR--MNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMDTTGGKSTCTGDSG 217
            ....||||.  .|.........||.|...|.||..|..|: ..::.:|:|..:.|| :.|.||.|
Mosquito   194 WTTISGWGETASNTGEALPMQQLRSVRSQVISNFSCTISFPLYLRSSNVCTSSDGG-APCVGDEG 257

  Fly   218 GPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSG 267
            ||:...:. .....:|.:.||....|||:.:|:|.||:|.||:||...:|
Mosquito   258 GPVTIVEE-DGQSTVIAIHSYTYSRGCTRSWPAVHTRVTDYLNWIEIYTG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/237 (31%)
AgaP_AGAP005705XP_001688714.1 Tryp_SPc 72..301 CDD:214473 74/237 (31%)
Tryp_SPc 73..302 CDD:238113 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.