DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP005597

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001688690.1 Gene:AgaP_AGAP005597 / 5666842 VectorBaseID:AGAP005597 Length:275 Species:Anopheles gambiae


Alignment Length:256 Identity:67/256 - (26%)
Similarity:105/256 - (41%) Gaps:61/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIA-GGELARANQFPYQVGLSIEEPNDMYCW---CGASLISDRYLLTAAHCVEKAVAITYYLGGV 91
            |:| .|..:...||.|...:.|...:::..:   |..:||:..|:|:...             |.
Mosquito    44 RLATNGYKSLPGQFLYHAYMHIRIESELSNYTRLCDGALITSNYILSVTQ-------------GC 95

  Fly    92 LRLAPRQLIRS------------------TNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIR 138
            |::...|.||:                  :...::|||       ...|.||||...|.|.:.::
Mosquito    96 LQVGSMQTIRNGTAILAFNKNNWEQRITFSGSAINLHP-------YKSIGLVRLDYPATLNEHVQ 153

  Fly   139 PIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPT--NI 201
            .||||.|:.|| ||:.:            |.|..:....||...|.||..|.....:...|  :|
Mosquito   154 LIRLPKLTDSR-SYEGM------------EGTTSNQYRSYVRNRVMSNAHCSQERPDFNATDMDI 205

  Fly   202 CMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            |.|...|.:.|:...|..|...|  :|..||||: :| :...|...||:|:.|::::.|||
Mosquito   206 CTDRYIGGAFCSTSLGSSLTIED--ENGVILIGL-AY-RIYYCDYNYPTVYARVSSFRDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/254 (26%)
AgaP_AGAP005597XP_001688690.1 Tryp_SPc 48..265 CDD:304450 65/252 (26%)
Tryp_SPc 48..262 CDD:214473 63/250 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.