DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and MASP1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:304 Identity:92/304 - (30%)
Similarity:138/304 - (45%) Gaps:59/304 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VQGRSI-SCL-DMGH------GIGGRIAGGELARANQFPYQVGLSIEE----PNDMYCWCGASLI 66
            |.|||: :|| :.|.      .:..||.||..|....||:|..:.:|:    |||.:...|| |:
Human   431 VLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGA-LL 494

  Fly    67 SDRYLLTAAHCVE-----------KAVAITYYLG--------GVLRLAPRQLIRSTNPEVHLHPD 112
            |..::|||||.:.           ....:|.|||        |.        :.|:...|.||||
Human   495 SASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGA--------VNSSAARVVLHPD 551

  Fly   113 WNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDEST------- 170
            :|.|:..:|||||:|.|...|...:.|:.||.| .......::..:.:|||..|...|       
Human   552 FNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRL-EPEGPAPHMLGLVAGWGISNPNVTVDEIISS 615

  Fly   171 ---AISDNLRYVYRFVESNEDCEYSYA------NIKPTNICMD-TTGGKSTCTGDSGGPLVYSDP 225
               .:||.|:||...|..:.:|:.||.      ::.....|.. ..|||.||.|||||..|..|.
Human   616 GTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDD 680

  Fly   226 VQNADILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWIGEVSGV 268
            :....::.|:.|:|....| :|....|:|:::.|:||:.|..|:
Human   681 LSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGL 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 82/271 (30%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512
CCP 374..439 CDD:153056 4/7 (57%)
Tryp_SPc 456..718 CDD:214473 82/271 (30%)
Tryp_SPc 457..718 CDD:238113 81/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.