DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and PRSS2

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:252 Identity:82/252 - (32%)
Similarity:123/252 - (48%) Gaps:41/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAV------------A 83
            :|.||.:...|..||||.|     |..|.:||.||||::::::|.||.:.|:            .
Human    23 KIVGGYICEENSVPYQVSL-----NSGYHFCGGSLISEQWVVSAGHCYKSAINSKLSGRGCEYHR 82

  Fly    84 ITYYLG----GVLRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPG 144
            |...||    .||. ...|.|.:.  ::..||.:|.::|:|||.|::|...|::...:..|.||.
Human    83 IQVRLGEHNIEVLE-GNEQFINAA--KIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPT 144

  Fly   145 LSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTN--ICMD-TT 206
            ...:..:    .::.||||..........|.|:.:...|.|..:||.||.. |.||  .|:. ..
Human   145 APPAAGT----ESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPG-KITNNMFCVGFLE 204

  Fly   207 GGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT-KGYPSVFTRITAYLDWI 262
            |||.:|.||||||:|.:..:|      |:.|:|  .||. |..|.|:|::..|:|||
Human   205 GGKDSCQGDSGGPVVSNGELQ------GIVSWG--YGCAQKNRPGVYTKVYNYVDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 80/250 (32%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 80/250 (32%)
Tryp_SPc 24..256 CDD:238113 82/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.