DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and tmprss9

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:259 Identity:78/259 - (30%)
Similarity:118/259 - (45%) Gaps:45/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVE---KAVAITYYLGGVL 92
            ||.||..||..::|:...|..:..:.    |||:||..::|||||||..   .....|..||.|:
Zfish   556 RIIGGVTARRGEWPWVGSLQYQRIHR----CGATLIHCKWLLTAAHCFRGDLNPAGYTVSLGSVI 616

  Fly    93 ------------RLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGL 145
                        |:.|             ||.:|..:::.|:|||.:...|....:|:.:.||  
Zfish   617 WSGLGALVIPVQRIIP-------------HPAFNSSTMDLDVALVEISIPAPKSYTIQTVCLP-- 666

  Fly   146 SSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSY-ANIKPTNICMD-TTGG 208
            |...:....:.....|||.:.::. .|::.|:.....|....||:.:| |.:....:|.. ..|.
Zfish   667 SPWHSFIKSMECYIIGWGAVREDG-MITNLLQKAQVGVIDQSDCQRAYGAELTDNMMCAGYMEGQ 730

  Fly   209 KSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWIGEVSGVHYP 271
            :.||.||||||||..:.: ....|.||||:|  .||.: |:|.|:.|.||..:||    .:|.|
Zfish   731 RDTCLGDSGGPLVCRETL-GRWFLAGVTSWG--HGCGRIGFPGVYMRATAVREWI----SIHLP 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 74/248 (30%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060
Tryp_SPc 232..462 CDD:238113
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113 75/252 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.