DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and zmp:0000001114

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_685356.5 Gene:zmp:0000001114 / 557248 ZFINID:ZDB-GENE-140106-74 Length:841 Species:Danio rerio


Alignment Length:261 Identity:70/261 - (26%)
Similarity:116/261 - (44%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEK--------AVAITYY 87
            ||.||:.|...::|:||.|..:.....   ||||:||:::||.||||..:        :..||| 
Zfish   602 RIVGGQNADVGEWPWQVSLHFKTQGHA---CGASIISNKWLLCAAHCFIQPDPSYKMTSSWITY- 662

  Fly    88 LGGVLRLAPRQLIRSTNPE-----------VHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIR 141
             .|         :|..|..           :..||::|..:.:.||:|:.|.:.....:::.||.
Zfish   663 -SG---------LRDQNTHDKSVQMRDLKTIITHPNYNDLTNDYDISLLELSQPLNFSNTVHPIC 717

  Fly   142 LPGLSS--SRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMD 204
            ||..|.  :..|..:|    :|||.:.:..:|.....:...:.:........:...:....:|..
Zfish   718 LPATSHVFTAGSSCFV----TGWGTLREGGSAAQILQKAEVKVINDTVCNMVTEGQVTSRMMCSG 778

  Fly   205 -TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCT-KGYPSVFTRITAYLDWIGEVSG 267
             .:||...|.||||||||.... .......|:.|:|:  ||. :..|.|:||:|...:||.|::.
Zfish   779 YLSGGVDACQGDSGGPLVCLSE-GGKWFQAGIVSWGE--GCARRNKPGVYTRVTKLREWIREITS 840

  Fly   268 V 268
            :
Zfish   841 L 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 67/253 (26%)
zmp:0000001114XP_685356.5 SEA 78..175 CDD:279699
CUB 208..322 CDD:238001
CUB 331..437 CDD:238001
LDLa 445..477 CDD:238060
LDLa 479..513 CDD:238060
LDLa 515..549 CDD:238060
LDLa 556..591 CDD:238060
Tryp_SPc 602..835 CDD:214473 67/253 (26%)
Tryp_SPc 603..838 CDD:238113 68/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.