DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and zgc:100868

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:247 Identity:77/247 - (31%)
Similarity:122/247 - (49%) Gaps:26/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCV--EKAVAITYYLGG 90
            :..||.||:.|....:|:||.|.    .|...:||.|||:::::||||||.  .....:..|| |
Zfish    33 LNSRIVGGQNAPVGAWPWQVSLQ----RDGSHFCGGSLINNQWILTAAHCFPNPSTTGLLVYL-G 92

  Fly    91 VLRLAPRQ--LIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYD 153
            :.:||..:  .:.|....:..||::|..:.:|||.|::|.......:.||||.|  .:|....::
Zfish    93 LQKLASFESYSMSSAVSNIIKHPNYNSDTEDNDITLLQLASTVSFSNYIRPICL--AASDSTFFN 155

  Fly   154 YVPAIASGWGRMNDESTAIS----DNLRYVYRFVESNEDCE--YSYANIKPTNICMD-TTGGKST 211
            ......:|||   :.:|.:|    ..|:.|...:..|..|.  |..:.|....:|.. ..|||.:
Zfish   156 GTLVWITGWG---NTATGVSLPSPGTLQEVQVPIVGNRKCNCLYGVSKITDNMVCAGLLQGGKDS 217

  Fly   212 CTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK-GYPSVFTRITAYLDWI 262
            |.||||||:|...  .:..|..|:.|:|  :||.: .:|.|:||::.|..||
Zfish   218 CQGDSGGPMVSKQ--GSVWIQSGIVSFG--TGCAQPNFPGVYTRVSKYQSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/242 (31%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 75/242 (31%)
Tryp_SPc 37..267 CDD:238113 76/243 (31%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.