DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and LOC548809

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001016055.2 Gene:LOC548809 / 548809 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:285 Identity:79/285 - (27%)
Similarity:128/285 - (44%) Gaps:33/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQISTILVFLLI-----LVQGRSISCLDMGHG-IGGRIAGGELARANQFPYQVGLSIEEPNDMYC 59
            |:.:.|::.||:     :.|..:.|....|.. :..||.||..|....:|:|:.|..:..:    
 Frog    21 MEFAGIILLLLVSASPTVSQNTTASPRICGSPLVSSRIVGGTDATNGAWPWQISLRYKGSH---- 81

  Fly    60 WCGASLISDRYLLTAAHCVEKAVAITYY---LGGV-LRLAPRQLIRSTNPEVHLHPDWNCQSLEN 120
            .||.|:||:::::|||||.|.:...:.|   ||.. |.:|....:.|:...|.::|.:.......
 Frog    82 ICGGSVISNQWIMTAAHCFEYSRTPSDYQVLLGAYQLSVASASELLSSVARVIVNPSFTIPGGPG 146

  Fly   121 DIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDEST-AISDNLRYVYRFVE 184
            ||||::|.......:.|.|:.:|  ||:...|:.:....:|||.:....| .....|:.|...:.
 Frog   147 DIALLKLTSPVAYTEYILPVCVP--SSASGFYEGMQCWVTGWGNIGSAVTLPYPQTLQQVMTPLI 209

  Fly   185 SNEDCEYSY----------ANIKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSY 238
            |...|...|          |.:....||.. ..|.|.:|.||||||||..  :|.....||:.|:
 Frog   210 SWSTCNQMYHVQSGISSNIAIVPKDQICAGYAAGQKDSCQGDSGGPLVCQ--LQGVWYQIGIVSW 272

  Fly   239 GKKSGCTK-GYPSVFTRITAYLDWI 262
            |  .||.: ..|.|:|.:..:..|:
 Frog   273 G--DGCAQASRPGVYTLVPNFKSWL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 71/247 (29%)
LOC548809NP_001016055.2 Tryp_SPc 57..294 CDD:214473 71/246 (29%)
Tryp_SPc 58..297 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.