DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and C1s1

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:117/262 - (44%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            ||.||:.|:...||:||  ....|.     ...:||::.::|||||.:||......|:|      
Mouse   443 RIFGGQPAKIENFPWQV--FFNHPR-----ASGALINEYWVLTAAHVLEKISDPLMYVG------ 494

  Fly    96 PRQLIRST---------NPEVHLHPDWNCQ-------SLENDIALVRLPEDALLCDSIRPIRLPG 144
             ...:|:|         :..|.:||.|..:       :.:||||||:|.:...:...:.||.|||
Mouse   495 -TMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKMGPKVSPICLPG 558

  Fly   145 LSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEY---SYANIKPTN------ 200
            .||..|.......:.||||  :.|......|||.....|.|.|.|:.   ....::|.:      
Mouse   559 TSSEYNVSPGDMGLISGWG--STEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDN 621

  Fly   201 -ICMDTTGGKSTCTGDSGGPLVYSDPVQNADI----LIGVTSYGKKSGCTKGYPSVFTRITAYLD 260
             ||....|..| |.|||||...:..|  |..:    :.|:.|:||:.| |.|   |:|::..|:|
Mouse   622 MICAGEKGVDS-CHGDSGGAFAFQVP--NVTVPKFYVAGLVSWGKRCG-TYG---VYTKVKNYVD 679

  Fly   261 WI 262
            ||
Mouse   680 WI 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 78/260 (30%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056
Tryp_SPc 443..681 CDD:214473 78/260 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.