DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and Prss53

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:280 Identity:68/280 - (24%)
Similarity:106/280 - (37%) Gaps:82/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SCLDMGHGIGGRIAGGELARA-NQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVA 83
            ||:    ..|...:||..|.| :|:|:...|.    :.....||.:|:|:..:||||||      
  Rat   331 SCV----ACGSLSSGGPQAGALSQWPWDARLK----HHGKLACGGALVSEVVVLTAAHC------ 381

  Fly    84 ITYYLGGVLRLAPRQLIR------STNPE-----------VHLHPDWNCQSLENDIALVRLPEDA 131
               ::|       ||.:.      ...||           .:.||:..     :|:|.:.|.:..
  Rat   382 ---FIG-------RQTLEEWSVGLGAGPEEWGLKQLILHGAYTHPEGG-----HDVAFLLLAQPV 431

  Fly   132 LLCDSIRPIRLPGLSSSRNSYDYVPAIASGW--------GRMNDESTAISDNLRYVYRFVESNED 188
            .|...:||:.|| .:..|     :|....||        |..:..:..::         |.....
  Rat   432 TLGPGLRPLCLP-YADHR-----LPDGEHGWVLGLTREAGINHPHTVPVT---------VLGPMA 481

  Fly   189 CEYSYA-------NIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKK-SGCT 245
            |...:|       .|.|..||....|....|.|.||.|||:.  ::....|.|:.|:|.. .|..
  Rat   482 CSRQHAASGSTGVPILPGMICTTVVGEPPHCEGLSGAPLVHE--IRGTWFLAGLHSFGDTCQGSA 544

  Fly   246 KGYPSVFTRITAYLDWIGEV 265
            |  |:||..::||.||:..:
  Rat   545 K--PAVFAALSAYEDWVSNL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 64/264 (24%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.