DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and cela1.2

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:253 Identity:79/253 - (31%)
Similarity:123/253 - (48%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLA 95
            |:.||...:.|.:|:||.|........|..||.|||....:|||||||::||:....:|      
 Frog    28 RVIGGTEVQRNSWPWQVSLQYLSGGSWYHTCGGSLIRANRVLTAAHCVDRAVSYRVVVG------ 86

  Fly    96 PRQLIRSTNPEVHL-------HPDWNCQSLE--NDIALVRLPEDALLCDSIRPIRLPG----LSS 147
            ...:.::...|.::       |.:||..::.  .||:::.|...|.|...::..:||.    |:.
 Frog    87 DHNIYQNDGTEQYISVSRIVKHANWNPNNIAAGYDISILHLSSSATLNSYVKLAQLPADNVVLAH 151

  Fly   148 SRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRF----VESNEDC---EYSYANIKPTNICMDT 205
            :.|      .:.:|||:     |:.:.||..|.:.    |.::..|   .|..:.:|.|.:|...
 Frog   152 NYN------CVVTGWGK-----TSNNGNLASVLQQAPLPVIAHSTCSSGSYWGSTVKSTMVCAGG 205

  Fly   206 TGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGC-TKGYPSVFTRITAYLDWI 262
            .|.:|.|.|||||||  :.||.....:.||||:...||| |...|:||||::||:.||
 Frog   206 DGVRSGCQGDSGGPL--NCPVNGVYQVHGVTSFVSSSGCSTYLKPTVFTRVSAYIGWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/251 (31%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.