DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and cela3a

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001011426.1 Gene:cela3a / 496909 XenbaseID:XB-GENE-996869 Length:275 Species:Xenopus tropicalis


Alignment Length:287 Identity:93/287 - (32%)
Similarity:136/287 - (47%) Gaps:43/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYL 71
            |||.::|:.| :..|....:....|:..||.|:...:|:||.|.:.........||.:||:||::
 Frog     4 LVFSVLLLSG-AYGCGVPTYAPSARVVNGESAKPYSWPWQVSLQVLINGVFIHNCGGTLIADRWI 67

  Fly    72 LTAAHCV-----EKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDW--NCQSLENDIALVRLPE 129
            ||||||:     .:||...|.|..  .....::....:.::.:|..|  ||....|||||:||..
 Frog    68 LTAAHCINFSRTNRAVVGDYDLAN--EEGAEEIFLIPSEDMFVHESWNNNCIPCGNDIALIRLSR 130

  Fly   130 DALLCDSIRPIRLPG----LSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC- 189
            ...:.|.::...||.    |.::.:.|      ||||||:. ......|.|:.....|...:.| 
 Frog   131 PVQISDKVQLSCLPPAGELLPNNFSCY------ASGWGRLY-TGGPYPDILQQALLPVVDYDHCS 188

  Fly   190 --EYSYANIKPTNICMDTTGG--KSTCTGDSGGPLVYSDPVQNAD---ILIGVTSYGKKSGC-TK 246
              ::..|.:|.:.:|   .||  :|.|.|||||||    ..|.||   .:.||||:|...|| |.
 Frog   189 QRDWWGATVKRSMVC---AGGDIRSVCNGDSGGPL----NCQGADGRWYVHGVTSFGSGYGCNTL 246

  Fly   247 GYPSVFTRITAYLDWI------GEVSG 267
            ..||||||::|:..||      ..|||
 Frog   247 KKPSVFTRVSAFNSWIQQTISENSVSG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 82/250 (33%)
cela3aNP_001011426.1 Tryp_SPc 28..265 CDD:238113 83/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.