DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and ACR

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001088.2 Gene:ACR / 49 HGNCID:126 Length:421 Species:Homo sapiens


Alignment Length:300 Identity:90/300 - (30%)
Similarity:136/300 - (45%) Gaps:52/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STILVFLLILVQGRSISCLDMGHGI--------GGRIAGGELARANQFPYQVGLSIEEPND-MYC 59
            :.||:.|.:.|..:..:..|...|:        |.||.||:.|:...:|:.|.|.|...|. .|.
Human     7 TAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSLQIFTYNSHRYH 71

  Fly    60 WCGASLISDRYLLTAAHC------------VEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPD 112
            .||.||::.|::||||||            |..|..|||.....:: ||.|  .....::.:|..
Human    72 TCGGSLLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPVK-APLQ--ERYVEKIIIHEK 133

  Fly   113 WNCQSLENDIALVRLPEDALLCDSIRPIRLP----GLSSSRNSYDYVPAIASGWGRMNDESTAIS 173
            :|..:..||||||.:.........|.|..||    ||.....|     ...:|||.:.:::...|
Human   134 YNSATEGNDIALVEITPPISCGRFIGPGCLPHFKAGLPRGSQS-----CWVAGWGYIEEKAPRPS 193

  Fly   174 DNLRYVYRFVESNED------C---EYSYANIKPTNICMDTTGGK-STCTGDSGGPLVYSDPVQN 228
            ..|      :|:..|      |   ::....::|||:|.....|| .||.|||||||:..|..::
Human   194 SIL------MEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQGDSGGPLMCKDSKES 252

  Fly   229 ADILIGVTSYGKKSGCTKG-YPSVFTRITAYLDWIGEVSG 267
            |.:::|:||:|  .||.:. .|.::|....||:||....|
Human   253 AYVVVGITSWG--VGCARAKRPGIYTATWPYLNWIASKIG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 80/258 (31%)
ACRNP_001088.2 Tryp_SPc 42..285 CDD:214473 80/258 (31%)
Tryp_SPc 43..288 CDD:238113 81/260 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..383
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.