DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP012502

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001230484.2 Gene:AgaP_AGAP012502 / 4578454 VectorBaseID:AGAP012502 Length:829 Species:Anopheles gambiae


Alignment Length:276 Identity:73/276 - (26%)
Similarity:106/276 - (38%) Gaps:73/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GELARANQFPYQVGLSIEEPNDMYCW-CGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQ 98
            |..::..:|.....:...:|.....| ||.|||...::||||||.:....          |.|..
Mosquito    19 GNPSKPGEFSAIAAIGWTKPGGTVNWNCGGSLIWANFILTAAHCTKDRDT----------LLPPD 73

  Fly    99 LIR-----------------STNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLS 146
            :||                 .|...|..||.:|..|:..||||:.|.|...:...:.|..| .|.
Mosquito    74 IIRIGDLNLYDDREDALVQERTIIRVIRHPLYNTSSVFYDIALLMLNEKVNIYFEVMPTCL-WLD 137

  Fly   147 SSRNSYDYVP---AIASGWGR----MNDESTAISDNLRYVYRFVESNEDCEYSYANIKPT----- 199
                  |.:|   ..|:|||.    ....:..|...|:.:     :|:|||..|:.:...     
Mosquito   138 ------DNIPFSKVEAAGWGTSGFGYGKTNILIKAELKLM-----ANKDCESYYSQVASVKNGLM 191

  Fly   200 --NIC-----MDTTGGKSTCTGDSGGP----LVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFT 253
              .:|     ||      ||.||||||    |::.|  .....|:||||:|  ..|....|.|:.
Mosquito   192 EHQLCAWDKVMD------TCPGDSGGPLQHKLIFGD--YKVPFLVGVTSFG--LSCGNSQPGVYV 246

  Fly   254 RITAYLDWIGEVSGVH 269
            :::.:..||.|....|
Mosquito   247 KVSKFGSWIVETLQQH 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 69/267 (26%)
AgaP_AGAP012502XP_001230484.2 Tryp_SPc 19..258 CDD:238113 71/270 (26%)
Tryp_SPc 19..255 CDD:214473 69/267 (26%)
Tryp_SPc 325..>418 CDD:304450
Trypsin 621..823 CDD:278516
Tryp_SPc 629..826 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.