DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP010798

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001231167.2 Gene:AgaP_AGAP010798 / 4577817 VectorBaseID:AGAP010798 Length:276 Species:Anopheles gambiae


Alignment Length:303 Identity:79/303 - (26%)
Similarity:112/303 - (36%) Gaps:82/303 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVFLLILVQGRSISCLDMG--------HGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCG 62
            ::|..|:|...||...|.:.        ..:..||..|..|....:||.|.:....|......||
Mosquito    16 LVVCCLLLYSSRSYLTLSLAVMSEVSAKQKMSFRIVNGTEATIVSYPYVVSIQRWTPRVKQHICG 80

  Fly    63 ASLISDRYLLTAAHCVEKAVAIT---------YYLGGVLRLAPRQLIRSTNPEVHLHPDWNCQSL 118
            .:|||:.::||||||.:|....|         :..||.|....:         |..|..::..:.
Mosquito    81 GTLISESWILTAAHCADKISPTTVMVRVNSSFFNRGGKLHRVEK---------VIKHERFSYATG 136

  Fly   119 ENDIAL------------VRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPA---IASGWGR-MND 167
            :.|..|            |:|||        |..|.|            ||   .|.|||. :..
Mosquito   137 DYDFGLLKLKQRYRRGTFVKLPE--------RRRRFP------------PAERCTAMGWGETLGR 181

  Fly   168 ESTAISDNLRYVYRFVESNEDCEYSYA---NIKPTNICMD-TTGGKSTCTGDSGGPLVYSDPVQN 228
            ||   .:.||.|...:.|...|..:|.   .|....:|.. ..|.:..|.|||||||:.      
Mosquito   182 ES---REQLRQVVMPIVSQAVCRKAYEGTDEITARMLCAGYPEGMRDACDGDSGGPLIC------ 237

  Fly   229 ADILIGVTSYGKKSGCTKGYPS---VFTRITAYLDWIGEVSGV 268
            ..|..||.|:.  .||.:  |:   |::.|....:||...:||
Mosquito   238 RGIQAGVISWA--IGCAQ--PNKYGVYSSIAEGREWIRNHTGV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 69/262 (26%)
AgaP_AGAP010798XP_001231167.2 Tryp_SPc 49..270 CDD:214473 69/262 (26%)
Tryp_SPc 50..273 CDD:238113 70/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.