DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP010627

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001230575.1 Gene:AgaP_AGAP010627 / 4577752 VectorBaseID:AGAP010627 Length:146 Species:Anopheles gambiae


Alignment Length:53 Identity:13/53 - (24%)
Similarity:22/53 - (41%) Gaps:13/53 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 STAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLV 221
            ::.:|.:..|:..|:..:..|  ||||           |.:.||...:..|.|
Mosquito    65 NSPLSKSREYIDPFLNLSHVC--SYAN-----------GRRGTCVNQTSCPNV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 13/53 (25%)
AgaP_AGAP010627XP_001230575.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.