powered by:
Protein Alignment Jon74E and AgaP_AGAP010627
DIOPT Version :9
Sequence 1: | NP_001189126.2 |
Gene: | Jon74E / 39959 |
FlyBaseID: | FBgn0023197 |
Length: | 271 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001230575.1 |
Gene: | AgaP_AGAP010627 / 4577752 |
VectorBaseID: | AGAP010627 |
Length: | 146 |
Species: | Anopheles gambiae |
Alignment Length: | 53 |
Identity: | 13/53 - (24%) |
Similarity: | 22/53 - (41%) |
Gaps: | 13/53 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 169 STAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLV 221
::.:|.:..|:..|:..:..| |||| |.:.||...:..|.|
Mosquito 65 NSPLSKSREYIDPFLNLSHVC--SYAN-----------GRRGTCVNQTSCPNV 104
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Jon74E | NP_001189126.2 |
Tryp_SPc |
31..262 |
CDD:214473 |
13/53 (25%) |
AgaP_AGAP010627 | XP_001230575.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.