DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP011429

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001237986.1 Gene:AgaP_AGAP011429 / 4577523 VectorBaseID:AGAP011429 Length:213 Species:Anopheles gambiae


Alignment Length:153 Identity:36/153 - (23%)
Similarity:56/153 - (36%) Gaps:45/153 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GGELARANQFPYQVGLSIEEPNDMYCW----------CGASLISDRYLLTAAHCVEKAVAITYYL 88
            |||.|...:|.:...:.         |          ||.|||:.|::|||:||   :|......
Mosquito    58 GGERAYKGEFQHMAAIG---------WTRSGATIDYLCGGSLITWRFVLTASHC---SVDSNNLP 110

  Fly    89 GGVLRLAPRQLIRSTNPE---------VHLHPDWNCQSLENDIALVRLPEDALLCDSI------R 138
            ...:||....|..:.:.|         ...||.:.......|||:|.|.::.:...:|      |
Mosquito   111 PDTVRLGDTDLASTDDDESAQQIPIARFIKHPQYRESRKYYDIAVVELEKNVIPNSAICVACVWR 175

  Fly   139 PIRLPGLSSSRNSYDYVPAIASG 161
            .:..||        |.:.|:..|
Mosquito   176 ELEAPG--------DLLDAVGFG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 36/153 (24%)
AgaP_AGAP011429XP_001237986.1 Tryp_SPc 58..>211 CDD:304450 36/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.