DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP012269

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001238284.2 Gene:AgaP_AGAP012269 / 4577485 VectorBaseID:AGAP012269 Length:649 Species:Anopheles gambiae


Alignment Length:283 Identity:67/283 - (23%)
Similarity:117/283 - (41%) Gaps:37/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VFLLILVQG----------RSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCG 62
            |.|.::.|.          |.:..:.:.|       .|..|:...:|:...:...:.:.|...||
Mosquito    14 VLLCVVAQSLGPNRLTCGKRRVKTIHLVH-------NGIDAKPGHWPWHAAIFHRKGDQMDYACG 71

  Fly    63 ASLISDRYLLTAAHCV------EKAVAITYYLGGV-LRLAPRQLIRSTNPEVHLHPDWNCQSLEN 120
            .|:|.:..:|||||||      .....|:.:||.| |:.....:...|..|:.:||.:|.....|
Mosquito    72 GSIIDENTILTAAHCVFLVNGLLPVSRISVHLGRVHLKEVSEFVQEHTVQELIVHPGYNSSRFVN 136

  Fly   121 DIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVES 185
            ||||::|.....:.:.::|:.|..:..::...........|:|.  :|...:|:.|:.....|..
Mosquito   137 DIALIKLTGSITMSEFVQPVCLWTMDKNQELIVGKTGTLVGFGL--NEQDVVSEQLKQASIGVVD 199

  Fly   186 NEDC----EYSYAN-IKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSY---GKKS 242
            ...|    ..|:|| :.....|.......|.|.|||||.|.::  |:....:.||.|:   .:::
Mosquito   200 ALTCIKSDRLSFANQLTAEMFCGGGQSNVSACNGDSGGGLFFN--VEGKWFVRGVVSFIPVRQRT 262

  Fly   243 G-CTKGYPSVFTRITAYLDWIGE 264
            | |.....:.:..:..||.||.:
Mosquito   263 GLCDPSKYTAYADVAKYLGWIDQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 60/246 (24%)
AgaP_AGAP012269XP_001238284.2 Tryp_SPc 41..285 CDD:238113 63/254 (25%)
Tryp_SPc 43..283 CDD:214473 60/243 (25%)
Tryp_SPc 418..636 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.