DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP006675

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001237857.2 Gene:AgaP_AGAP006675 / 4576700 VectorBaseID:AGAP006675 Length:302 Species:Anopheles gambiae


Alignment Length:248 Identity:90/248 - (36%)
Similarity:133/248 - (53%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIAGGELARANQFPYQVGL--SIEEPNDMYCWCGASLISDRYLLTAAHC-VEKAVAI----TYYL 88
            ||..|:.|...|||||:.|  :......:   ||.::|::.::|||||| |:.|.|:    |..|
Mosquito    55 RIVNGQEAVPGQFPYQIALLSNFAAGGGL---CGGTIITNTFILTAAHCVVDGAGALATDGTAIL 116

  Fly    89 GGVLRLA---PRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRN 150
            |...|.|   .:|.|......|.:||.::...:.||||.|||...|:..:.::||.||..|.|| 
Mosquito   117 GAHNRTATEPTQQRIGFVRDGVFVHPSYSATLIRNDIATVRLNSPAVFNERVQPIELPARSDSR- 180

  Fly   151 SYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNEDC--EYSYANIKPTNICMDTTGGKSTCT 213
            ::..:...|||:||.:|.....||.:.|....|.:|..|  .::...:...|:|:|.|||:|.|.
Mosquito   181 TFAGMIGTASGFGRTSDALPGASDVVMYTSNPVMTNAACVSAWNIILVSDQNVCLDATGGRSVCN 245

  Fly   214 GDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVS 266
            |||||||...|..::.:  ||:.|:....||..|.|||:.||:.|.|:|.:.|
Mosquito   246 GDSGGPLTVQDGGESLE--IGIASFVSAQGCASGIPSVWVRISFYRDFIEQNS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 88/242 (36%)
AgaP_AGAP006675XP_001237857.2 Tryp_SPc 55..292 CDD:214473 88/242 (36%)
Tryp_SPc 56..295 CDD:238113 88/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.