DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP006710

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_565496.1 Gene:AgaP_AGAP006710 / 4576607 VectorBaseID:AGAP006710 Length:258 Species:Anopheles gambiae


Alignment Length:279 Identity:83/279 - (29%)
Similarity:128/279 - (45%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW---CGASLISD 68
            :|.:|::|....::.|.:......|:.|||:|:....||||.|.:  |.    |   ||.||:::
Mosquito     8 VVSVLLVVSAAKVTKLVLDDHYVNRVVGGEVAKNGSAPYQVSLQV--PG----WGHNCGGSLLNN 66

  Fly    69 RYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTN-----PEVHLHPDWNCQSLENDIALVRLP 128
            |::||||||:     :.|....::.|.....::...     .::..|..:|.....|||.|:||.
Mosquito    67 RWVLTAAHCL-----VGYEPSDLMVLVGTNSLKEGGELLKVDKLLYHSRYNRPQFHNDIGLMRLE 126

  Fly   129 EDALLCDSIRPIRLPGLSSSRNSYDY----VPAIA----SGWGR--MNDESTAISDNLRYVYRFV 183
            :         |::   .|....|.:|    ||..|    :||||  .|.....:..:|..|   .
Mosquito   127 Q---------PVQ---FSELVQSVEYLEKAVPVNATVRLTGWGRTSTNGNVPTLLQSLNVV---T 176

  Fly   184 ESNEDCEYSYANIKPTN-----ICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSG 243
            .|||||:....|  |.|     :|..|..|:..|.|||||||||...      |:||.::|..  
Mosquito   177 LSNEDCKAKMGN--PENVDLGHVCTLTKAGEGACNGDSGGPLVYEGK------LVGVVNFGVP-- 231

  Fly   244 CTKGYPSVFTRITAYLDWI 262
            |.:|:|..|.|::.|.:|:
Mosquito   232 CGRGFPDGFARVSYYHEWV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 78/253 (31%)
AgaP_AGAP006710XP_565496.1 Tryp_SPc 32..250 CDD:214473 78/253 (31%)
Tryp_SPc 33..253 CDD:238113 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.