DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon74E and AgaP_AGAP005592

DIOPT Version :9

Sequence 1:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001237685.2 Gene:AgaP_AGAP005592 / 4576199 VectorBaseID:AGAP005592 Length:299 Species:Anopheles gambiae


Alignment Length:244 Identity:77/244 - (31%)
Similarity:112/244 - (45%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GELARANQFPYQVGLSIEEPNDMYCW-CGASLISDRYLLTAAHCVEKAV---AITY---YLGGVL 92
            |.||...||||...:.|:..:..|.. |..|||:.:|:||.|.|:.:.|   .|.|   .||.:.
Mosquito    62 GYLAFPGQFPYHAEVLIKPKSLSYLHSCAGSLITLKYVLTTAACLYRWVNENDIEYAFVTLGSLF 126

  Fly    93 R--LAPRQLIRSTNPEVHLHPDWNCQSLE-NDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDY 154
            .  ....|.|..|:..:|.||.::..:.| |:||.:.|...|.|...::|||||.|:..| :|:.
Mosquito   127 NGDTQWEQRINFTDDGIHTHPLYSKPNYEFNNIATIHLDCPATLNRFVQPIRLPRLTDMR-TYEM 190

  Fly   155 VPAIASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPT------NICMDTTGGKSTCT 213
            :...|||        ......|:|:...|.|||||:   .:|.|.      :||.::..|...|.
Mosquito   191 MEGTASG--------AKFIGGLKYLRNQVMSNEDCQ---RDILPVFIITAQHICTNSLIGGVFCN 244

  Fly   214 GDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262
            .:.|..|...|  ||..:|||...|  ...|...||:...|::.:.|||
Mosquito   245 REFGSSLTVED--QNGRVLIGFADY--LFLCDSNYPTRHVRVSYFRDWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 75/242 (31%)
AgaP_AGAP005592XP_001237685.2 Tryp_SPc 62..292 CDD:238113 77/244 (32%)
Tryp_SPc 62..289 CDD:214473 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.